PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 269aa    MW: 29467.3 Da    PI: 8.4745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587267.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-191156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell ++v+++G+++W+ I++ ++ gR++k+c++rw + 
   XP_009587267.1 11 KGPWSPEEDELLQRLVEEHGPRNWSIISKSIP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding56.66.1e-1865107347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a+++lG++ W+tIar +  gRt++ +k++w++ 
   XP_009587267.1  65 PFTAEEDETILKAHAKLGNK-WATIARFLS-GRTDNAIKNHWNST 107
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.858161IPR017930Myb domain
SuperFamilySSF466891.08E-328104IPR009057Homeodomain-like
SMARTSM007171.0E-171059IPR001005SANT/Myb domain
PfamPF002492.4E-191156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-261264IPR009057Homeodomain-like
CDDcd001673.57E-171355No hitNo description
SMARTSM007174.5E-1562110IPR001005SANT/Myb domain
PROSITE profilePS5129421.74963112IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2365111IPR009057Homeodomain-like
PfamPF002497.9E-1565107IPR001005SANT/Myb domain
CDDcd001671.14E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEAIKETGRI KGPWSPEEDE LLQRLVEEHG PRNWSIISKS IPGRSGKSCR LRWCNQLSPQ  60
VEHRPFTAEE DETILKAHAK LGNKWATIAR FLSGRTDNAI KNHWNSTLKR KCPSTSDDLS  120
FETPQQPLKR SSSIGPGTIS MNPGSPSGSD LSDSGFPGIA QSNVYRPAAR PSGVLPPSVP  180
DPPTFLSLSL PGSGFNEATG RVTPQVAEPD PAPSSAPGIM PQNLPVIENY SFGPSIMEKQ  240
LFSPEFLAVL QNMIHKEVKN YTEKGQKYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-40101123105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-40101123105C-Myb DNA-Binding Domain
1msf_C1e-40101123105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6368190.0EF636819.1 Nicotiana langsdorffii x Nicotiana sanderae sucrose responsive element binding factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587267.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW19e-79MYB44_ARATH; Transcription factor MYB44
TrEMBLB3F8H81e-173B3F8H8_NICLS; Sucrose responsive element binding factor 1
STRINGPOPTR_0002s12410.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-79myb domain protein 73